PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.2771s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 420aa    MW: 46052.8 Da    PI: 6.6383
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.2771s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.82.4e-28152206156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k +++WtpeLH+rFveaveqL G +kA+P++ilelm+v++Lt+++v+SHLQkYR++
  Araha.2771s0001.1.p 152 KVKVDWTPELHRRFVEAVEQL-GVDKAVPSRILELMGVHCLTRHNVASHLQKYRSH 206
                          5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.721149208IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-27150209IPR009057Homeodomain-like
SuperFamilySSF466892.51E-18151209IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-26152206IPR006447Myb domain, plants
PfamPF002494.1E-8155204IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MLALSPATRD GCEGASEFLD TSCGFTINPE EEDEFPDFAD HGDLLDIIDF DDIFGVAGDV  60
LPDLEIDPEI LSGDFSDHMN ASSTITTTSD KTDSQGETNK SISGKGEEVV SKRDDAAAET  120
VTYDRESDRK RKYSSSASSK NNRISNNEGK RKVKVDWTPE LHRRFVEAVE QLGVDKAVPS  180
RILELMGVHC LTRHNVASHL QKYRSHRKHL LAREAEAANW TRKRHIYGVD TGGNLNGRSK  240
TGWLAPAPTL GFPPPPPMAV VPPPVHHHHF RPLHVWGHPT VDQSIMPHVW PKHLPPPSTV  300
MPNPPFWVSD SPYWHPMHNG ATPYLPTVAT RFRAPPVAGI PHALPPHHTV YKPNHGFGGA  360
RPPVDLHPSK ESVDAAIGDV LTRPWLPLPL GLKPPAVDGV MTELHRHGVS EVPPTASCA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-15149204257ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0624890.0AB062489.1 Arabidopsis thaliana mRNA for GPRI1, complete cds.
GenBankAY0267720.0AY026772.1 Arabidopsis thaliana golden2-like transcription factor (GLK1) mRNA, complete cds.
GenBankAY0546000.0AY054600.1 Arabidopsis thaliana Unknown protein (At2g20570; F23N11.11) mRNA, complete cds.
GenBankAY0814850.0AY081485.1 Arabidopsis thaliana unknown protein (At2g20570) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002884211.10.0hypothetical protein ARALYDRAFT_480887
SwissprotQ9SIV30.0GLK1_ARATH; Transcription activator GLK1
TrEMBLD7L4H90.0D7L4H9_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.3__3588__AT2G20570.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22092773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.10.0GBF's pro-rich region-interacting factor 1